Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Type Natriuretic Peptide (1-53) (human)

C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.

Product Specifications

Field of Research

Cardiovascular Research

Purity

≥95%

Molecular Weight

5801.81

Notes

For research use only.

AA Sequence

DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS9BP Human Gene Knockout Kit (CRISPR)
KN418269 1 Kit

RGS9BP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Angiotensin Converting Enzyme 1 (ACE) Mouse Monoclonal Antibody [Clone ID: OTI2C8]
CF812211 100 µg

Angiotensin Converting Enzyme 1 (ACE) Mouse Monoclonal Antibody [Clone ID: OTI2C8]

Sign In for Pricing
View Details
Collagen IV (COL4A2) (NM_001846) Human Over-expression Lysate
LY419704 100 µg

Collagen IV (COL4A2) (NM_001846) Human Over-expression Lysate

Sign In for Pricing
View Details
Diacetyl (6-Chloro 7-Piperazinyl 1-Ethyl-1,4-dihydro-4-oxo-3-quinolinecarboxy Borate)
TRC-D679330-50MG 50 mg

Diacetyl (6-Chloro 7-Piperazinyl 1-Ethyl-1,4-dihydro-4-oxo-3-quinolinecarboxy Borate)

Sign In for Pricing
View Details
CELA3B (CELA3B/1218), CF568 conjugate, 0.1mg/mL
BNC681218-100 1x 100 µL

CELA3B (CELA3B/1218), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HOXA9 Human Gene Knockout Kit (CRISPR)
KN400559 1 Kit

HOXA9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details