Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreastatin (swine)

Pancreastatin (swine) is a 49-residue peptide which strongly inhibits glucose-induced insulin release. Pancreastatin (swine) can be isolated and characterized from porcine pancreas.

Product Specifications

Purity

≥95%

Molecular Weight

5103.4

Notes

For research use only.

AA Sequence

GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRN Rabbit Polyclonal Antibody (PE)
orb484635 100 µL

SPRN Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
IFABP/FABP2 ELISA Kit| Rabbit Intestinal Fatty Acid Binding Prot
EF016809 96 Tests

IFABP/FABP2 ELISA Kit| Rabbit Intestinal Fatty Acid Binding Prot

Sign In for Pricing
View Details
Setx Mouse Gene Knockout Kit (CRISPR)
KN515635 1 Kit

Setx Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD44 monoclonal antibody
orb1724409-01 50 µL

CD44 monoclonal antibody

Sign In for Pricing
View Details
CD44 monoclonal antibody
orb1724409-02 100 µL

CD44 monoclonal antibody

Sign In for Pricing
View Details
Recombinant KRT19 Antibody / Cytokeratin 19
V5448-20UG 20 µg

Recombinant KRT19 Antibody / Cytokeratin 19

Sign In for Pricing
View Details