Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreastatin (swine)

Pancreastatin (swine) is a 49-residue peptide which strongly inhibits glucose-induced insulin release. Pancreastatin (swine) can be isolated and characterized from porcine pancreas.

Product Specifications

Purity

≥95%

Molecular Weight

5103.4

Notes

For research use only.

AA Sequence

GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neuregulin 1, NRG-1 ELISA Kit
YLA1122HU-01 48 Tests

Human Neuregulin 1, NRG-1 ELISA Kit

Sign In for Pricing
View Details
Human Neuregulin 1, NRG-1 ELISA Kit
YLA1122HU-02 96 Tests

Human Neuregulin 1, NRG-1 ELISA Kit

Sign In for Pricing
View Details
Milbemycin α13
HY-N15094 1 Each

Milbemycin α13

Sign In for Pricing
View Details
NPTX2 Peptide - middle region
MBS3246565-01 0.1 mg

NPTX2 Peptide - middle region

Sign In for Pricing
View Details
NPTX2 Peptide - middle region
MBS3246565-02 5x 0.1 mg

NPTX2 Peptide - middle region

Sign In for Pricing
View Details
CCNH Antibody (C-term)
MBS9208160-01 0.08 mL

CCNH Antibody (C-term)

Sign In for Pricing
View Details