Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreastatin (swine)

Pancreastatin (swine) is a 49-residue peptide which strongly inhibits glucose-induced insulin release. Pancreastatin (swine) can be isolated and characterized from porcine pancreas.

Product Specifications

Purity

≥95%

Molecular Weight

5103.4

Notes

For research use only.

AA Sequence

GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11C Monoclonal Antibody
BT-MCA2040-01 50 µL

CD11C Monoclonal Antibody

Sign In for Pricing
View Details
CD11C Monoclonal Antibody
BT-MCA2040-02 100 µL

CD11C Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Human Papilloma Virus Antibody (718-67)
NB100-73153 0.2 mg

Mouse Monoclonal Human Papilloma Virus Antibody (718-67)

Sign In for Pricing
View Details
Anti-GSTK1 (Rabbit, Monoclonal)
A113958 100 µL

Anti-GSTK1 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Pcmtd2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4687907 1.0 µg DNA

Pcmtd2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
AMPK α2 Rabbit mAb
C06186-100uL 100 µL

AMPK α2 Rabbit mAb

Sign In for Pricing
View Details