Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreastatin (swine)

Pancreastatin (swine) is a 49-residue peptide which strongly inhibits glucose-induced insulin release. Pancreastatin (swine) can be isolated and characterized from porcine pancreas.

Product Specifications

Purity

≥95%

Molecular Weight

5103.4

Notes

For research use only.

AA Sequence

GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD274 protein, Fc-tagged
CD274-366M 200 µg

Recombinant Mouse CD274 protein, Fc-tagged

Sign In for Pricing
View Details
IBRDC2 (RNF144B) Mouse Monoclonal Antibody [Clone ID: OTI7H2]
CF500698 100 µg

IBRDC2 (RNF144B) Mouse Monoclonal Antibody [Clone ID: OTI7H2]

Sign In for Pricing
View Details
PCSK4 3'UTR Luciferase Stable Cell Line
TU017591 1.0 mL

PCSK4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Vesicle-fusing ATPase
339479-01 50 µg

Vesicle-fusing ATPase

Sign In for Pricing
View Details
Vesicle-fusing ATPase
339479-02 100 µg

Vesicle-fusing ATPase

Sign In for Pricing
View Details
C20orf111 Protein Lysate (Human) with C-Ha Tag
14270031 100 µg

C20orf111 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details