Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreastatin (swine)

Pancreastatin (swine) is a 49-residue peptide which strongly inhibits glucose-induced insulin release. Pancreastatin (swine) can be isolated and characterized from porcine pancreas.

Product Specifications

Purity

≥95%

Molecular Weight

5103.4

Notes

For research use only.

AA Sequence

GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse ASIP/Agouti Protein CF
9619-AG-050 50 µg

Recombinant Mouse ASIP/Agouti Protein CF

Sign In for Pricing
View Details
Anti-EPO Antibody Picoband® (Dylight594 Conjugate)
A00484-1-Dylight594 100 µg

Anti-EPO Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
APBB2 Adenovirus (Mouse)
12132055 1.0 mL

APBB2 Adenovirus (Mouse)

Sign In for Pricing
View Details
PAN2 Knockout MES-OV Polyclonal Cells
ARG6360 1 Million

PAN2 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Mycoplasma Hyopneumoniae rplV Protein (aa 1-203) (strain J / ATCC 25934 / NCTC 10110)
VAng-Lsx06576-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Hyopneumoniae rplV Protein (aa 1-203) (strain J / ATCC 25934 / NCTC 10110)

Sign In for Pricing
View Details
Rfpl4 Protein Vector (Mouse) (pPB-C-His)
PV223666 500 ng

Rfpl4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details