Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glu20-Salmon Calcitonin

Glu20-Salmon Calcitonin

Product Specifications

Purity

≥95%

Molecular Weight

3432.84

Notes

For research use only.

AA Sequence

CSNLSTCVLGKLSQELHKLETYPRTNTGSGTP-NH2 (disulfide Bridge Cys1-Cys7)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-100 1x 100 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-500 1x 500 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-100 1x 100 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), CF568 conjugate, 0.1mg/mL
BNC681147-500 1x 500 µL

CD45RB (PTPRC/1147), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF740 conjugate, 0.1mg/mL
BNC740675-500 1x 500 µL

Cytokeratin 6 (LHK6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinol Binding Protein-1 (RBP/872), CF640R conjugate, 0.1mg/mL
BNC400872-500 1x 500 µL

Retinol Binding Protein-1 (RBP/872), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details