Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreatic Polypeptide, avian

Pancreatic Polypeptide, avian

Product Specifications

Purity

≥95%

Molecular Weight

4237.69

Notes

For research use only.

AA Sequence

GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL22 N terminal protein (Avi, His tag)
PDEH100867-01 20 µg

Recombinant Human IL22 N terminal protein (Avi, His tag)

Sign In for Pricing
View Details
Recombinant Human IL22 N terminal protein (Avi, His tag)
PDEH100867-02 100 µg

Recombinant Human IL22 N terminal protein (Avi, His tag)

Sign In for Pricing
View Details
Recombinant Human IL22 N terminal protein (Avi, His tag)
PDEH100867-03 500 µg

Recombinant Human IL22 N terminal protein (Avi, His tag)

Sign In for Pricing
View Details
Recombinant Human IL22 N terminal protein (Avi, His tag)
PDEH100867-04 1 mg

Recombinant Human IL22 N terminal protein (Avi, His tag)

Sign In for Pricing
View Details
PE Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032D-01 50 Tests

PE Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
PE Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032D-02 100 Tests

PE Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details