Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreatic Polypeptide, avian

Pancreatic Polypeptide, avian

Product Specifications

Purity

≥95%

Molecular Weight

4237.69

Notes

For research use only.

AA Sequence

GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lactoylglutathione Lyase (CPTC-GLO1-3), 0.2mg/mL
BNUB2495-100 1x 100 µL

Lactoylglutathione Lyase (CPTC-GLO1-3), 0.2mg/mL

Sign In for Pricing
View Details
ZNF580 (NM_001163423) Human Recombinant Protein
TP328746 20 µg

ZNF580 (NM_001163423) Human Recombinant Protein

Sign In for Pricing
View Details
HSP27 (G3.1), 0.2mg/mL
BNUB0861-100 1x 100 µL

HSP27 (G3.1), 0.2mg/mL

Sign In for Pricing
View Details
Mouse Acsm3 activation kit by CRISPRa
GA203759 1 Kit

Mouse Acsm3 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Hydroxy Omeprazole Preparation Kit
TRC-H948860-5MG 5 mg

4-Hydroxy Omeprazole Preparation Kit

Sign In for Pricing
View Details
LRRC3 Antibody
KC-3765-01 50 μL

LRRC3 Antibody

Sign In for Pricing
View Details