Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreatic Polypeptide, avian

Pancreatic Polypeptide, avian

Product Specifications

Purity

≥95%

Molecular Weight

4237.69

Notes

For research use only.

AA Sequence

GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), CF568 conjugate, 0.1mg/mL
BNC681810-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/1190), CF647 conjugate, 0.1mg/mL
BNC471190-100 1x 100 µL

Cytokeratin 18 (KRT18/1190), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Angiopoietin 2 Polyclonal Antibody
E-AB-60103-01 60 μL

Angiopoietin 2 Polyclonal Antibody

Sign In for Pricing
View Details
Angiopoietin 2 Polyclonal Antibody
E-AB-60103-02 120 μL

Angiopoietin 2 Polyclonal Antibody

Sign In for Pricing
View Details
Angiopoietin 2 Polyclonal Antibody
E-AB-60103-03 200 µL

Angiopoietin 2 Polyclonal Antibody

Sign In for Pricing
View Details
Rat sIgA (Secretory Immunoglobulin A) ELISA Kit
E-EL-R0875-01 24 Tests

Rat sIgA (Secretory Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details