Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreatic Polypeptide, avian

Pancreatic Polypeptide, avian

Product Specifications

Purity

≥95%

Molecular Weight

4237.69

Notes

For research use only.

AA Sequence

GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butanilicaine Hydrochloride
TRC-B693055-10MG 10 mg

Butanilicaine Hydrochloride

Sign In for Pricing
View Details
OBP2B (NM_014581) Human Recombinant Protein
TP318732L 1 mg

OBP2B (NM_014581) Human Recombinant Protein

Sign In for Pricing
View Details
TRIM31 Rabbit Polyclonal Antibody
TA382819 100 µL

TRIM31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB515841 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
RNF21 (TRIM34) (NM_001003827) Human Over-expression Lysate
LC424025 20 µg

RNF21 (TRIM34) (NM_001003827) Human Over-expression Lysate

Sign In for Pricing
View Details
Celsr1 Mouse Gene Knockout Kit (CRISPR)
KN503119 1 Kit

Celsr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details