Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro-Atrial Natriuretic Factor (26-55) (human)

Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity.

Product Specifications

Field of Research

Cardiovascular Research

Purity

≥95%

Molecular Weight

3508

Notes

For research use only.

AA Sequence

NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MitoROS Brite™ 670 *Optimized for Detecting Reactive Oxygen Species (ROS) in Mitochondria*
15999-AAT 1 mg

MitoROS Brite™ 670 *Optimized for Detecting Reactive Oxygen Species (ROS) in Mitochondria*

Sign In for Pricing
View Details
Anti-FGFR3 Antibody [JM110-33]
ET1703-65TR 20 µL

Anti-FGFR3 Antibody [JM110-33]

Sign In for Pricing
View Details
2-Heptacosanone
TRC-H265240-500MG 500 mg

2-Heptacosanone

Sign In for Pricing
View Details
BstV2I, 200U
RE1238 200 U

BstV2I, 200U

Sign In for Pricing
View Details
Recombinant LC3A Monoclonal Antibody
E-AB-81578-01 50 µL

Recombinant LC3A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant LC3A Monoclonal Antibody
E-AB-81578-02 100 µL

Recombinant LC3A Monoclonal Antibody

Sign In for Pricing
View Details