Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro-Atrial Natriuretic Factor (26-55) (human)

Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity.

Product Specifications

Field of Research

Cardiovascular Research

Purity

≥95%

Molecular Weight

3508

Notes

For research use only.

AA Sequence

NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ephrin Type A Receptor 3 (EPHA3) ELISA Kit
RD-EPHA3-Hu-01 96 Tests

Human Ephrin Type A Receptor 3 (EPHA3) ELISA Kit

Sign In for Pricing
View Details
Human Ephrin Type A Receptor 3 (EPHA3) ELISA Kit
RD-EPHA3-Hu-02 48 Tests

Human Ephrin Type A Receptor 3 (EPHA3) ELISA Kit

Sign In for Pricing
View Details
Butyraldehyde 2,4-Dinitrophenylhydrazone-d3
TRC-B755452-5MG 5 mg

Butyraldehyde 2,4-Dinitrophenylhydrazone-d3

Sign In for Pricing
View Details
Mouse Adgre1 activation kit by CRISPRa
GA201235 1 Kit

Mouse Adgre1 activation kit by CRISPRa

Sign In for Pricing
View Details
PE/iFluor® 700 Anti-human CD19 Antibody *HIB19*
101921X0-AAT 25 Tests

PE/iFluor® 700 Anti-human CD19 Antibody *HIB19*

Sign In for Pricing
View Details
4-Aminopyridine N-Oxide
TRC-A629010-500MG 500 mg

4-Aminopyridine N-Oxide

Sign In for Pricing
View Details