Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro-Atrial Natriuretic Factor (26-55) (human)

Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity.

Product Specifications

Field of Research

Cardiovascular Research

Purity

≥95%

Molecular Weight

3508

Notes

For research use only.

AA Sequence

NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vertical Autoclave BAVT-304-A
BAVT-304-A 1 Unit

Vertical Autoclave BAVT-304-A

Sign In for Pricing
View Details
Mouse Efna1 activation kit by CRISPRa
GA201189 1 Kit

Mouse Efna1 activation kit by CRISPRa

Sign In for Pricing
View Details
Progesterone (6-5E-3F), CF405S conjugate, 0.1mg/mL
BNC040236-500 1x 500 µL

Progesterone (6-5E-3F), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Human CD244 Antibody[C1.7]
E-AB-F1374E-01 20 Tests

APC Anti-Human CD244 Antibody[C1.7]

Sign In for Pricing
View Details
APC Anti-Human CD244 Antibody[C1.7]
E-AB-F1374E-02 100 Tests

APC Anti-Human CD244 Antibody[C1.7]

Sign In for Pricing
View Details
APC Anti-Human CD244 Antibody[C1.7]
E-AB-F1374E-03 2x 100 Tests

APC Anti-Human CD244 Antibody[C1.7]

Sign In for Pricing
View Details