Exendin 4 (3-39)
Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis.
Product Specifications
Purity
≥95%
Molecular Weight
3992.47
Notes
For research use only.
AA Sequence
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV731196 1.0 µg DNA
LINC00278 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details