Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 4 (3-39)

Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis.

Product Specifications

Purity

≥95%

Molecular Weight

3992.47

Notes

For research use only.

AA Sequence

EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR13Z1P-set siRNA/shRNA/RNAi Lentivector (Human)
34972091 4x 500 ng

OR13Z1P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Human Zinc Finger Homeobox Protein 1B (ZFHX1B) ELISA Kit
DL-ZFHX1B-Hu-01 48 Tests

Human Zinc Finger Homeobox Protein 1B (ZFHX1B) ELISA Kit

Sign In for Pricing
View Details
Human Zinc Finger Homeobox Protein 1B (ZFHX1B) ELISA Kit
DL-ZFHX1B-Hu-02 96 Tests

Human Zinc Finger Homeobox Protein 1B (ZFHX1B) ELISA Kit

Sign In for Pricing
View Details
RAD54L2 Conjugated Antibody
MBS9448861-01 0.1 mL (Biotin)

RAD54L2 Conjugated Antibody

Sign In for Pricing
View Details
RAD54L2 Conjugated Antibody
MBS9448861-02 0.1 mL (AF350)

RAD54L2 Conjugated Antibody

Sign In for Pricing
View Details
RAD54L2 Conjugated Antibody
MBS9448861-03 0.1 mL (AF405)

RAD54L2 Conjugated Antibody

Sign In for Pricing
View Details