Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr1] -pTH (1-34), human

(Tyr1) -pTH (1-34) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

4193.87

Notes

For research use only.

AA Sequence

YVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSL1D1 shRNA Plasmid (h)
sc-93449-SH 20 µg

RSL1D1 shRNA Plasmid (h)

Sign In for Pricing
View Details
VE-Cadherin CDH5-/VE Rabbit Polyclonal Antibody (PE)
orb2575482 100 µg

VE-Cadherin CDH5-/VE Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Sequestosome 1 (SQSTM1) Antibody (Biotin)
abx313344-01 20 µg

Sequestosome 1 (SQSTM1) Antibody (Biotin)

Sign In for Pricing
View Details
Sequestosome 1 (SQSTM1) Antibody (Biotin)
abx313344-02 50 µg

Sequestosome 1 (SQSTM1) Antibody (Biotin)

Sign In for Pricing
View Details
Sequestosome 1 (SQSTM1) Antibody (Biotin)
abx313344-03 100 µg

Sequestosome 1 (SQSTM1) Antibody (Biotin)

Sign In for Pricing
View Details
Sequestosome 1 (SQSTM1) Antibody (Biotin)
abx313344-04 200 µg

Sequestosome 1 (SQSTM1) Antibody (Biotin)

Sign In for Pricing
View Details