Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr1] -pTH (1-34), human

(Tyr1) -pTH (1-34) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

4193.87

Notes

For research use only.

AA Sequence

YVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA3B Protein Vector (Mouse) (pPM-C-HA)
43343024 500 ng

SEMA3B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
HSBP1L1, Recombinant, Human, aa1-74, His-Tag (Heat Shock Factor Binding Protein 1-Like)
218235-01 100 µg

HSBP1L1, Recombinant, Human, aa1-74, His-Tag (Heat Shock Factor Binding Protein 1-Like)

Sign In for Pricing
View Details
HSBP1L1, Recombinant, Human, aa1-74, His-Tag (Heat Shock Factor Binding Protein 1-Like)
218235-02 500 µg

HSBP1L1, Recombinant, Human, aa1-74, His-Tag (Heat Shock Factor Binding Protein 1-Like)

Sign In for Pricing
View Details
Rabbit anti-CD354 Antibody
MBS4504983-01 0.05 mL

Rabbit anti-CD354 Antibody

Sign In for Pricing
View Details
Rabbit anti-CD354 Antibody
MBS4504983-02 0.1 mL

Rabbit anti-CD354 Antibody

Sign In for Pricing
View Details
Rabbit anti-CD354 Antibody
MBS4504983-03 5x 0.1 mL

Rabbit anti-CD354 Antibody

Sign In for Pricing
View Details