Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr1] -pTH (1-34), human

(Tyr1) -pTH (1-34) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

4193.87

Notes

For research use only.

AA Sequence

YVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STYX AAV siRNA Pooled Vector
45816161 1.0 µg

STYX AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Anti-PP1C beta Rabbit Monoclonal Antibody
MA4687-.05 50 µL

Anti-PP1C beta Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Ccnd3 (NM_001081636) Mouse Untagged Clone
MC226838 10 µg

Ccnd3 (NM_001081636) Mouse Untagged Clone

Sign In for Pricing
View Details
Bin1 Rabbit Polyclonal Antibody (Biotin)
orb2105026 100 µL

Bin1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human C-Type Lectin Domain Family 4, Member K (CLEC4K) ELISA Kit
RD-CLEC4K-Hu-48Tests 48 Tests

Human C-Type Lectin Domain Family 4, Member K (CLEC4K) ELISA Kit

Sign In for Pricing
View Details
NAALADL1 AAV siRNA Pooled Vector
31379161 1.0 µg

NAALADL1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details