β-Endorphin, human
β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.
Product Specifications
Purity
≥95%
Solubility
Water: ≥50mg/mL. DMSO: 100mg/mL
Molecular Weight
3465.06
Notes
For research use only.
AA Sequence
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
105300U1-AAT 500 Tests
MFluor™ Green 620 Anti-human CD53 Antibody *HI29*
Sign In for Pricing
View Details 033905-ML550 100 µL
CI150, NT (LURAP1L, Leucine rich adaptor protein 1-like) (MaxLight 550) discontinued
Sign In for Pricing
View Details LV631979 1.0 µg DNA
Olr1369 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details 
bs-3335R-BF750 100 µL
Phospho-PKR (Thr446) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
Sign In for Pricing
View Details