Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Endorphin, human

β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.

Product Specifications

Purity

≥95%

Solubility

Water: ≥50mg/mL. DMSO: 100mg/mL

Molecular Weight

3465.06

Notes

For research use only.

AA Sequence

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DDX49 Protein
E30P64751A 50 µg

Recombinant Human DDX49 Protein

Sign In for Pricing
View Details
Rat Ifnb1/Interferon beta ELISA Kit
EK00420E 96 Tests

Rat Ifnb1/Interferon beta ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal FGF14 Antibody [DyLight 650]
NBP3-00172C 0.1 mL

Rabbit Polyclonal FGF14 Antibody [DyLight 650]

Sign In for Pricing
View Details
AIPL1 Double Nickase Plasmid (m2)
sc-431098-NIC-2 20 µg

AIPL1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Human Galectin-8
MBS145141-01 0.002 mg

Recombinant Human Galectin-8

Sign In for Pricing
View Details
Recombinant Human Galectin-8
MBS145141-02 0.01 mg

Recombinant Human Galectin-8

Sign In for Pricing
View Details