Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y, human, rat

Neuropeptide Y, human, rat

Product Specifications

Purity

≥95%

Molecular Weight

4271.7

Notes

For research use only.

AA Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc25a28 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4960206 1.0 µg DNA

Slc25a28 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Genesig® Advanced kit for N.gonorrhoeae
Z-Path-N.gonorrhoeae 150 Tests

Genesig® Advanced kit for N.gonorrhoeae

Sign In for Pricing
View Details
Rat Monoclonal Oval Cell Marker Antibody (OC2-2A6) [Janelia Fluor 635]
NBP1-18967JF635 0.1 mL

Rat Monoclonal Oval Cell Marker Antibody (OC2-2A6) [Janelia Fluor 635]

Sign In for Pricing
View Details
NGF Double Nickase Plasmid (h)
sc-400292-NIC 20 µg

NGF Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS557635 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
PLEKHF2 (NM_024613) Human Tagged Lenti ORF Clone
RC203964L1 10 µg

PLEKHF2 (NM_024613) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details