Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y, human, rat

Neuropeptide Y, human, rat

Product Specifications

Purity

≥95%

Molecular Weight

4271.7

Notes

For research use only.

AA Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Supt4h1 Rabbit Polyclonal Antibody (FITC)
orb2133181 100 µL

Supt4h1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MRP-L23 Lentiviral Activation Particles (h)
sc-410488-LAC 200 µL

MRP-L23 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
BCL2L12 Knockout HT29 Polyclonal Cells
ARG33141 1 Million

BCL2L12 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
Desethyl terbumeton-d3
HY-W714205S 1 Each

Desethyl terbumeton-d3

Sign In for Pricing
View Details
ICOSLG sgRNA CRISPR Lentivector (Human) (Target 3)
K1011504 1.0 µg DNA

ICOSLG sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
UltraPolymer Goat anti-Mouse IgG (H&L) Conjugated to HRP, affinity purified, min x w/bovine, horse, human, pig or rabbit serum proteins
MBS689578-01 15 mL

UltraPolymer Goat anti-Mouse IgG (H&L) Conjugated to HRP, affinity purified, min x w/bovine, horse, human, pig or rabbit serum proteins

Sign In for Pricing
View Details