Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHI, rat

PHI, (rat) is a 27 amino acid peptide.PHI, (rat) is used to find peptide hormones and other active peptides.

Product Specifications

Purity

≥95%

Molecular Weight

3011.45

Notes

For research use only.

AA Sequence

HADGVFTSDYSRLLGQISAKKYLESLI-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 1 Alpha (IL1a) Mini Samples ELISA Kit
MBS2089491-01 24 Strip Well

Mouse Interleukin 1 Alpha (IL1a) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 1 Alpha (IL1a) Mini Samples ELISA Kit
MBS2089491-02 48 Well

Mouse Interleukin 1 Alpha (IL1a) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 1 Alpha (IL1a) Mini Samples ELISA Kit
MBS2089491-03 96 Well

Mouse Interleukin 1 Alpha (IL1a) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 1 Alpha (IL1a) Mini Samples ELISA Kit
MBS2089491-04 5x 96 Well

Mouse Interleukin 1 Alpha (IL1a) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 1 Alpha (IL1a) Mini Samples ELISA Kit
MBS2089491-05 10x 96 Well

Mouse Interleukin 1 Alpha (IL1a) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Anti-Cyclin B1/CCNB1 Antibody Picoband®, Dylight550 Conjugate
A00745-1-Dylight550 100 µg

Anti-Cyclin B1/CCNB1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details