Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro-ANF (26-55), human

Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity.

Product Specifications

Purity

≥95%

Molecular Weight

3507.96

Notes

For research use only.

AA Sequence

NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIPC3 Antibody
KC-43629-01 50 μL

GIPC3 Antibody

Sign In for Pricing
View Details
GIPC3 Antibody
KC-43629-02 100 µL

GIPC3 Antibody

Sign In for Pricing
View Details
GIPC3 Antibody
KC-43629-03 1 mL

GIPC3 Antibody

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF647 conjugate, 0.1mg/mL
BNC472984-100 1x 100 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pure Mouse IgG Gel Immuno Absorbant Immobilized Antibodies
AGK-026-2 2 mL

Pure Mouse IgG Gel Immuno Absorbant Immobilized Antibodies

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS502896 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details