Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro-ANF (26-55), human

Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity.

Product Specifications

Purity

≥95%

Molecular Weight

3507.96

Notes

For research use only.

AA Sequence

NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMBP Antibody
KC-380-01 50 μL

AMBP Antibody

Sign In for Pricing
View Details
AMBP Antibody
KC-380-02 100 µL

AMBP Antibody

Sign In for Pricing
View Details
AMBP Antibody
KC-380-03 1 mL

AMBP Antibody

Sign In for Pricing
View Details
GAB4 Antibody
8C12388-AAT 50 µg

GAB4 Antibody

Sign In for Pricing
View Details
Human PTPRQ activation kit by CRISPRa
GA117768 1 Kit

Human PTPRQ activation kit by CRISPRa

Sign In for Pricing
View Details
Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF405S conjugate, 0.1mg/mL
BNC040035-500 1x 500 µL

Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details