Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro-ANF (26-55), human

Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity.

Product Specifications

Purity

≥95%

Molecular Weight

3507.96

Notes

For research use only.

AA Sequence

NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF488A conjugate, 0.1mg/mL
BNC882000-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wdr76 Mouse Gene Knockout Kit (CRISPR)
KN519386 1 Kit

Wdr76 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
myosin heavy chain 3 (MYH3) (NM_002470) Human Recombinant Protein
TP318098L 1 mg

myosin heavy chain 3 (MYH3) (NM_002470) Human Recombinant Protein

Sign In for Pricing
View Details
Glutaredoxin 1 (GLRX) Human Gene Knockout Kit (CRISPR)
KN419385 1 Kit

Glutaredoxin 1 (GLRX) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
BNC140017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benzyl 2,3,4-Tri-O-benzyl-Beta-D-glucopyranoside
TRC-B315870-50MG 50 mg

Benzyl 2,3,4-Tri-O-benzyl-Beta-D-glucopyranoside

Sign In for Pricing
View Details