Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro-ANF (26-55), human

Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity.

Product Specifications

Purity

≥95%

Molecular Weight

3507.96

Notes

For research use only.

AA Sequence

NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF594 conjugate, 0.1mg/mL
BNC941060-100 1x 100 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Hydroxybutyryl-L-carnitine Chloride
TRC-H824655-2.5MG 2.5 mg

4-Hydroxybutyryl-L-carnitine Chloride

Sign In for Pricing
View Details
(S)-1-Linoleoyl-2,3-isopropylidene-rac-glycerol
TRC-L467905-500MG 500 mg

(S)-1-Linoleoyl-2,3-isopropylidene-rac-glycerol

Sign In for Pricing
View Details
O3-Desethyl Apremilast
TRC-D291185-50MG 50 mg

O3-Desethyl Apremilast

Sign In for Pricing
View Details
IRE1 (ERN1) Human Gene Knockout Kit (CRISPR)
KN215023 1 Kit

IRE1 (ERN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CHD4 (3F2/4), CF647 conjugate, 0.1mg/mL
BNC473077-500 1x 500 µL

CHD4 (3F2/4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details