Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro-ANF (26-55), human

Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity.

Product Specifications

Purity

≥95%

Molecular Weight

3507.96

Notes

For research use only.

AA Sequence

NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Astn1 Mouse Gene Knockout Kit (CRISPR)
KN501701 1 Kit

Astn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant OTX2 Antibody
RC-16005-01 50 μL

Recombinant OTX2 Antibody

Sign In for Pricing
View Details
Recombinant OTX2 Antibody
RC-16005-02 100 µL

Recombinant OTX2 Antibody

Sign In for Pricing
View Details
Recombinant OTX2 Antibody
RC-16005-03 1 mL

Recombinant OTX2 Antibody

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (rLAMP4/824), CF647 conjugate, 0.1mg/mL
BNC473434-100 1x 100 µL

CD68 (Macrophage Marker) (rLAMP4/824), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Slap (SLA) (NM_001282965) Human Tagged ORF Clone
RG236220 10 µg

Slap (SLA) (NM_001282965) Human Tagged ORF Clone

Sign In for Pricing
View Details