Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peptide F, bovine

Peptide F, bovine is a proenkephalin peptide F from in bovine brain and adrenal medulla. Enkephalinergic system involves in pain transmission.

Product Specifications

Purity

≥95%

Molecular Weight

3845.42

Notes

For research use only.

AA Sequence

YGGFMKKMDELYPLEVEEEANGGEVLGKRYGGFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tigd3 Mouse Gene Knockout Kit (CRISPR)
KN517564 1 Kit

Tigd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CREB1 Human Gene Knockout Kit (CRISPR)
KN202115 1 Kit

CREB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NRF1 (NRF1/2608), CF640R conjugate, 0.1mg/mL
BNC402608-500 1x 500 µL

NRF1 (NRF1/2608), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spiramycin
TRC-S682373-25G 25 g

Spiramycin

Sign In for Pricing
View Details
Recombinant Human Mesothelin/MSLN Protein (His & Avi Tag)
PKSH033798-01 20 µg

Recombinant Human Mesothelin/MSLN Protein (His & Avi Tag)

Sign In for Pricing
View Details
Recombinant Human Mesothelin/MSLN Protein (His & Avi Tag)
PKSH033798-02 100 µg

Recombinant Human Mesothelin/MSLN Protein (His & Avi Tag)

Sign In for Pricing
View Details