Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peptide F, bovine

Peptide F, bovine is a proenkephalin peptide F from in bovine brain and adrenal medulla. Enkephalinergic system involves in pain transmission.

Product Specifications

Purity

≥95%

Molecular Weight

3845.42

Notes

For research use only.

AA Sequence

YGGFMKKMDELYPLEVEEEANGGEVLGKRYGGFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A4]
TA805763BM 100 µL

MARK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A4]

Sign In for Pricing
View Details
PDX1 Mouse Monoclonal Antibody [Clone ID: OTI7F7]
CF807531 100 µg

PDX1 Mouse Monoclonal Antibody [Clone ID: OTI7F7]

Sign In for Pricing
View Details
MECOM Antibody
KC-37452-01 50 μL

MECOM Antibody

Sign In for Pricing
View Details
MECOM Antibody
KC-37452-02 100 µL

MECOM Antibody

Sign In for Pricing
View Details
MECOM Antibody
KC-37452-03 1 mL

MECOM Antibody

Sign In for Pricing
View Details
STK31 Rabbit Polyclonal Antibody
TA382133 100 µL

STK31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details