Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin, human

Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors.

Product Specifications

Purity

≥95%

Solubility

Water: 1 mg/mL

Molecular Weight

3157.44

Notes

For research use only.

AA Sequence

GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vamp5 Mouse shRNA Lentiviral Particle (Locus ID 53620)
TL517717V 500 µL Each

Vamp5 Mouse shRNA Lentiviral Particle (Locus ID 53620)

Sign In for Pricing
View Details
Complement factor B (CFB) (NM_001710) Human Over-expression Lysate
LH19698V 100 µg

Complement factor B (CFB) (NM_001710) Human Over-expression Lysate

Sign In for Pricing
View Details
Glucocorticoid receptor Antibody, APC Conjugated
bs-0252R-APC 100 µL

Glucocorticoid receptor Antibody, APC Conjugated

Sign In for Pricing
View Details
Mouse Anti-Porcine CD4-FITC
4515-02 0.5 mg

Mouse Anti-Porcine CD4-FITC

Sign In for Pricing
View Details
Ccdc129 AAV siRNA Pooled Vector
15192164 1.0 µg

Ccdc129 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human GHRL (Ghrelin) ELISA Kit
MBS8800944-01 48 Well

Human GHRL (Ghrelin) ELISA Kit

Sign In for Pricing
View Details