Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin, human

Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors.

Product Specifications

Purity

≥95%

Solubility

Water: 1 mg/mL

Molecular Weight

3157.44

Notes

For research use only.

AA Sequence

GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear TF Y subunit alpha Recombinant Protein
orb1228713 0.05 mg

Nuclear TF Y subunit alpha Recombinant Protein

Sign In for Pricing
View Details
GLS Recombinant Monoclonal Antibody
RAC09029-01 50 µL

GLS Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
GLS Recombinant Monoclonal Antibody
RAC09029-02 100 µL

GLS Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Anemarsaponin C
TBZ0024 20mg

Anemarsaponin C

Sign In for Pricing
View Details
CUDC-101
T3108-01 5 mg

CUDC-101

Sign In for Pricing
View Details
CUDC-101
T3108-02 10 mg

CUDC-101

Sign In for Pricing
View Details