Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gastric Inhibitory Peptide (GIP), human

GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.

Product Specifications

Field of Research

Gastroenterology & Hepatology

Purity

≥95%

Molecular Weight

4983.64

Notes

For research use only.

AA Sequence

YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-500 1x 500 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-100 1x 100 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF405S conjugate, 0.1mg/mL
BNC041070-500 1x 500 µL

TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (F1G4), CF740 conjugate, 0.1mg/mL
BNC740767-100 1x 100 µL

GnRH-Receptor (LHRH Receptor) (F1G4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54), CF405S conjugate, 0.1mg/mL
BNC040054-100 1x 100 µL

HCG-beta (HCGb/54), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details