Gastric Inhibitory Peptide (GIP), human
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.
Product Specifications
Field of Research
Gastroenterology & Hepatology
Purity
≥95%
Molecular Weight
4983.64
Notes
For research use only.
AA Sequence
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog