Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-34), human

Teriparatide (Human parathyroid hormone- (1-34) ) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone- (1-34) ) can be used for osteoporosis research.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Solubility

Water: 100 mg/mL

Molecular Weight

4117.8

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigment red 266
orb2565501-01 50 mg

Pigment red 266

Sign In for Pricing
View Details
Pigment red 266
orb2565501-02 10 mg

Pigment red 266

Sign In for Pricing
View Details
Rabbit Transcription factor SOX 11 (SOX11) ELISA Kit
GTR10354656 96 Well

Rabbit Transcription factor SOX 11 (SOX11) ELISA Kit

Sign In for Pricing
View Details
PCMV6-SLIT3-3*FLAG
BZ67922 1 Vial

PCMV6-SLIT3-3*FLAG

Sign In for Pricing
View Details
IL20RB antibody
FNab04250 100 µg

IL20RB antibody

Sign In for Pricing
View Details
PFI-2 10mM * 1mL in DMSO
A14216-10mM-D 10 mM x 1mL in DMSO

PFI-2 10mM * 1mL in DMSO

Sign In for Pricing
View Details