Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-34), human

Teriparatide (Human parathyroid hormone- (1-34) ) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone- (1-34) ) can be used for osteoporosis research.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Solubility

Water: 100 mg/mL

Molecular Weight

4117.8

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pomp (NM_025624) Mouse Tagged Lenti ORF Clone
MR200906L4 10 µg

Pomp (NM_025624) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tomosyn1/2 control protein
183-0P 100 µg

Tomosyn1/2 control protein

Sign In for Pricing
View Details
Chicken Macrophage erythroblast attacher, MAEA ELISA Kit
MBS9320688 Inquire

Chicken Macrophage erythroblast attacher, MAEA ELISA Kit

Sign In for Pricing
View Details
GPT2 (NM_133443) Human Over-expression Lysate
LS084706-20ug 20 µg

GPT2 (NM_133443) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Anti-Desmoglein 3 Antibody IgA ELISA Kit
MBS7255812-01 48 Well

Mouse Anti-Desmoglein 3 Antibody IgA ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Desmoglein 3 Antibody IgA ELISA Kit
MBS7255812-02 96 Well

Mouse Anti-Desmoglein 3 Antibody IgA ELISA Kit

Sign In for Pricing
View Details