Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amylin, human

Endogenous peptide. Potent amylin, calcitonin (EC50 = 0.67 nM), CGRP and adrenomedullin receptor agonist. Potently inhibits insulin-stimulated glucose uptake in skeletal muscle cells (IC50 = 12 pM) . Implicated in type II diabetes. Active in vivo. Rat (ab142399) and feline (ab142397) amylin also available.

Product Specifications

Purity

≥95%

Molecular Weight

3903.4

Notes

For research use only.

AA Sequence

KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse soluble myosin heavy chain 1, sMHC-1 ELISA Kit
CSB-E11155m-01 48 Tests

Mouse soluble myosin heavy chain 1, sMHC-1 ELISA Kit

Sign In for Pricing
View Details
Mouse soluble myosin heavy chain 1, sMHC-1 ELISA Kit
CSB-E11155m-02 96 Tests

Mouse soluble myosin heavy chain 1, sMHC-1 ELISA Kit

Sign In for Pricing
View Details
Mouse soluble myosin heavy chain 1, sMHC-1 ELISA Kit
CSB-E11155m-03 5x 96 Tests

Mouse soluble myosin heavy chain 1, sMHC-1 ELISA Kit

Sign In for Pricing
View Details
Mouse soluble myosin heavy chain 1, sMHC-1 ELISA Kit
CSB-E11155m-04 10x 96 Tests

Mouse soluble myosin heavy chain 1, sMHC-1 ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione (GSH) ELISA Kit-Competitive
EK6F763 96 Tests

Mouse Glutathione (GSH) ELISA Kit-Competitive

Sign In for Pricing
View Details
hsa-miR-887-3p Primers
MPH03944 150 µL / 10 µM

hsa-miR-887-3p Primers

Sign In for Pricing
View Details