Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amylin, human

Endogenous peptide. Potent amylin, calcitonin (EC50 = 0.67 nM), CGRP and adrenomedullin receptor agonist. Potently inhibits insulin-stimulated glucose uptake in skeletal muscle cells (IC50 = 12 pM) . Implicated in type II diabetes. Active in vivo. Rat (ab142399) and feline (ab142397) amylin also available.

Product Specifications

Purity

≥95%

Molecular Weight

3903.4

Notes

For research use only.

AA Sequence

KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEG (16.67%) with 3.33M NaCl
40120935-1 100 mL

PEG (16.67%) with 3.33M NaCl

Sign In for Pricing
View Details
CanAg CEA EIA
401-10 For 96 Determinations

CanAg CEA EIA

Sign In for Pricing
View Details
BDC 2.5(A)
5-00756 4x 5 mg

BDC 2.5(A)

Sign In for Pricing
View Details
Lrp1 Mouse shRNA Plasmid (Locus ID 16971)
TG512679 1 Kit

Lrp1 Mouse shRNA Plasmid (Locus ID 16971)

Sign In for Pricing
View Details
EFNA4, ID (EPH-related receptor tyrosine kinase ligand 4, LERK-4, Ephrin-A4, EFNA4, EPLG4, LERK4) (PE)
MBS6294587-01 0.2 mL

EFNA4, ID (EPH-related receptor tyrosine kinase ligand 4, LERK-4, Ephrin-A4, EFNA4, EPLG4, LERK4) (PE)

Sign In for Pricing
View Details
EFNA4, ID (EPH-related receptor tyrosine kinase ligand 4, LERK-4, Ephrin-A4, EFNA4, EPLG4, LERK4) (PE)
MBS6294587-02 5x 0.2 mL

EFNA4, ID (EPH-related receptor tyrosine kinase ligand 4, LERK-4, Ephrin-A4, EFNA4, EPLG4, LERK4) (PE)

Sign In for Pricing
View Details