Amylin, human
Endogenous peptide. Potent amylin, calcitonin (EC50 = 0.67 nM), CGRP and adrenomedullin receptor agonist. Potently inhibits insulin-stimulated glucose uptake in skeletal muscle cells (IC50 = 12 pM) . Implicated in type II diabetes. Active in vivo. Rat (ab142399) and feline (ab142397) amylin also available.
Product Specifications
Purity
≥95%
Molecular Weight
3903.4
Notes
For research use only.
AA Sequence
KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
20298121 3x 1.0µg DNA
FBXL2 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 
MBS6224644-01 0.1 mL
SIK1 (Salt-inducible Kinase 1, Serine/threonine-protein Kinase SIK1, SIK-1, SIK, Serine/threonine-protein Kinase SNF1-like Kinase 1, Serine/threonine-protein Kinase SNF1LK, SNF1LK, MSK) (MaxLight 650)
Sign In for Pricing
View Details MBS6224644-02 5x 0.1 mL
SIK1 (Salt-inducible Kinase 1, Serine/threonine-protein Kinase SIK1, SIK-1, SIK, Serine/threonine-protein Kinase SNF1-like Kinase 1, Serine/threonine-protein Kinase SNF1LK, SNF1LK, MSK) (MaxLight 650)
Sign In for Pricing
View Details 
MBS9002782 Inquire
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) ENTS Polyclonal Antibody
Sign In for Pricing
View Details K3534902 1.0 µg DNA
Cds1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details