What is the catalog number for Amylin, rat?

The catalog number for Amylin, rat is orb2693385.

What sizes are available for Amylin, rat?

Amylin, rat is available in the following size(s): 5 mg, 10 mg.

How many pack sizes does Amylin, rat come in?

Amylin, rat is available in 2 different pack sizes.

Is Amylin, rat in stock?

Amylin, rat is currently made to order / not held in immediate stock. Contact us for lead time.

Amylin, rat

Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.

Product Specifications

Purity

≥95%

Solubility

Water: 100 mg/mL. DMSO: 50 mg/mL

Molecular Weight

3920.44

Notes

For research use only.

AA Sequence

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GB300028-M-10μg 10 μg

Recombinant Mouse PGF Protein (His-tag)

Sign In for Pricing

View Details

MBS8414698-01 0.02 mg

Human LRRC8B Protein Lysate

Sign In for Pricing

View Details

MBS8414698-02 5x 0.02 mg

Human LRRC8B Protein Lysate

Sign In for Pricing

View Details

SL19689R-01 50 µL

Rabbit Anti-PYCR1 antibody

Sign In for Pricing

View Details

SL19689R-02 100 µL

Rabbit Anti-PYCR1 antibody

Sign In for Pricing

View Details

NB500-130MFV500 0.1 mL

Rabbit Polyclonal Cyclin E2 Antibody [mFluor Violet 500 SE]

Sign In for Pricing

View Details