Amylin, rat
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
Product Specifications
Purity
≥95%
Solubility
Water: 100 mg/mL. DMSO: 50 mg/mL
Molecular Weight
3920.44
Notes
For research use only.
AA Sequence
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0102-30N-ML750 100 µL
Karyopherin beta 1, NT (Karyopherin Subunit beta-1, KPNB1, Importin beta 1, Importin Subunit beta-1, IMB1, IPO1, IPOB, Impnb, Importin 90, MGC2155, MGC2156, MGC2157, Nuclear Factor p97, NTF97, Pore Targeting Complex 97kD Subunit, PTAC97) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
A00984-3-FITC 100 µg/Vial
Anti-NEDD4 Antibody Picoband®, FITC Conjugate
Sign In for Pricing
View Details RC234536 10 µg
Ensconsin (MAP7) (NM_001198619) Human Tagged ORF Clone
Sign In for Pricing
View Details