Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amylin (8-37), rat

Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.

Product Specifications

Purity

≥95%

Solubility

Water: 50 mg/mL

Molecular Weight

3200.63

Notes

For research use only.

AA Sequence

ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR1I3 Protein Lysate
OCOA15424-20UG 20 µg

NR1I3 Protein Lysate

Sign In for Pricing
View Details
Anti-ARL4D antibody
STJ119178 100 µl

Anti-ARL4D antibody

Sign In for Pricing
View Details
Assurance Grade Chromium for AA and ICP 1000 ug/mL (1000 PPM) 250mL in 2% HNO3
PLCR2-2T 250 mL

Assurance Grade Chromium for AA and ICP 1000 ug/mL (1000 PPM) 250mL in 2% HNO3

Sign In for Pricing
View Details
Human desmogleins 3 antibody (IgG) ELISA Kit
CSB-E13896h-01 24 Well

Human desmogleins 3 antibody (IgG) ELISA Kit

Sign In for Pricing
View Details
Human desmogleins 3 antibody (IgG) ELISA Kit
CSB-E13896h-02 96 Well

Human desmogleins 3 antibody (IgG) ELISA Kit

Sign In for Pricing
View Details
Human desmogleins 3 antibody (IgG) ELISA Kit
CSB-E13896h-03 5x 96 Well

Human desmogleins 3 antibody (IgG) ELISA Kit

Sign In for Pricing
View Details