Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stresscopin, human

Stresscopin, human

Product Specifications

Purity

≥95%

Molecular Weight

4367.24

Notes

For research use only.

AA Sequence

TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Box of 100 very fast qualitative filter, 50 mm
QL01A0050 Box of 100

Box of 100 very fast qualitative filter, 50 mm

Sign In for Pricing
View Details
MPZL3 Rabbit Polyclonal Antibody (HRP)
orb2094647 100 µL

MPZL3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Lentiviral human ARSK shRNA (UAS) - Lentiviral human ARSK shRNA (UAS, RFP) plasmid
GTR15102469 1 Vial

Lentiviral human ARSK shRNA (UAS) - Lentiviral human ARSK shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
DET1 polyclonal antibody
BS78133-01 50 µL

DET1 polyclonal antibody

Sign In for Pricing
View Details
DET1 polyclonal antibody
BS78133-02 100 µL

DET1 polyclonal antibody

Sign In for Pricing
View Details
Mouse Monoclonal TM4SF18 Antibody (211116) [Janelia Fluor 646]
FAB3509J 0.1 mL

Mouse Monoclonal TM4SF18 Antibody (211116) [Janelia Fluor 646]

Sign In for Pricing
View Details