Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stresscopin, human

Stresscopin, human

Product Specifications

Purity

≥95%

Molecular Weight

4367.24

Notes

For research use only.

AA Sequence

TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMS 599626 hydrochloride
FB18844-01 10 mg

BMS 599626 hydrochloride

Sign In for Pricing
View Details
BMS 599626 hydrochloride
FB18844-02 50 mg

BMS 599626 hydrochloride

Sign In for Pricing
View Details
NUP107 Rabbit Polyclonal Antibody (APC-Cy7)
orb1598672 100 µL

NUP107 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
RPS3 Rabbit Polyclonal Antibody
orb585741 100 µL

RPS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IgG (Cy3)
537769-01 100 µL

IgG (Cy3)

Sign In for Pricing
View Details
IgG (Cy3)
537769-02 500 µL

IgG (Cy3)

Sign In for Pricing
View Details