Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-40), rat

β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD) . β-Amyloid (1-40) (rat) increases 45Ca2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4233.81

Notes

For research use only.

AA Sequence

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Igfbp4 ORF Vector (Rat) (pORF)
24324016 1.0 µg DNA

Igfbp4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Neuropilin-1 (CD304)
299197 50 µg

Neuropilin-1 (CD304)

Sign In for Pricing
View Details
Biotin-PEG-Alk (MW 2000)
HY-147206B 1 Each

Biotin-PEG-Alk (MW 2000)

Sign In for Pricing
View Details
RalA-Binding Protein 1 (RALBP1) Antibody
abx237095 100 µg

RalA-Binding Protein 1 (RALBP1) Antibody

Sign In for Pricing
View Details
SNRPD1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44972151 3x 1.0 µg DNA

SNRPD1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
MURF3 (TRIM54) Mouse Monoclonal Antibody [Clone ID: LBI2C7]
AMM16198V 100 µL

MURF3 (TRIM54) Mouse Monoclonal Antibody [Clone ID: LBI2C7]

Sign In for Pricing
View Details