Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-40), rat

β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD) . β-Amyloid (1-40) (rat) increases 45Ca2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4233.81

Notes

For research use only.

AA Sequence

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Respiratory Factor 1 (NRF1, NRF-1, Alpha-PAL, Alpha Palindromic-binding Protein) (APC)
130612-APC 100 µL

Nuclear Respiratory Factor 1 (NRF1, NRF-1, Alpha-PAL, Alpha Palindromic-binding Protein) (APC)

Sign In for Pricing
View Details
PKC iota Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-12689R-APC-Cy5.5 100 µL

PKC iota Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
NDNL2 (NSMCE3) (NM_138704) Human Tagged ORF Clone
RG208815 10 µg

NDNL2 (NSMCE3) (NM_138704) Human Tagged ORF Clone

Sign In for Pricing
View Details
MADCAM1 (NM_130762) Human Recombinant Protein
TP312381L 1 mg

MADCAM1 (NM_130762) Human Recombinant Protein

Sign In for Pricing
View Details
Water-Soluble Non-Edible Pigments Test Kit
E-IA-C058 100 Tests

Water-Soluble Non-Edible Pigments Test Kit

Sign In for Pricing
View Details
JR14a
E1048-100mg 100 mg

JR14a

Sign In for Pricing
View Details