Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-40), rat

β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD) . β-Amyloid (1-40) (rat) increases 45Ca2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4233.81

Notes

For research use only.

AA Sequence

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC45B CRISPR/Cas9 KO Plasmid (h)
sc-407188 20 µg

UNC45B CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Eastern equine encephalitis PCR kit
PCR-VH159-96R 100T

Eastern equine encephalitis PCR kit

Sign In for Pricing
View Details
Gm15140 3'UTR Lenti-reporter-Luc Vector
21899084 1.0 µg

Gm15140 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Cytokeratin Pan antibody
10R-2096 100 ul

Cytokeratin Pan antibody

Sign In for Pricing
View Details
Phospho-EGFR (Ser991) Rabbit Polyclonal Antibody (PE-Cy5.5)
orb904733 100 µL

Phospho-EGFR (Ser991) Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 3 (HCN3) Antibody
abx233789 100 µg

Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 3 (HCN3) Antibody

Sign In for Pricing
View Details