Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-40), rat

β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD) . β-Amyloid (1-40) (rat) increases 45Ca2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4233.81

Notes

For research use only.

AA Sequence

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indobufen Impurity 74
RM-I042601-01 10 mg

Indobufen Impurity 74

Sign In for Pricing
View Details
Indobufen Impurity 74
RM-I042601-02 25 mg

Indobufen Impurity 74

Sign In for Pricing
View Details
Indobufen Impurity 74
RM-I042601-03 50 mg

Indobufen Impurity 74

Sign In for Pricing
View Details
Indobufen Impurity 74
RM-I042601-04 100 mg

Indobufen Impurity 74

Sign In for Pricing
View Details
Human Somatotropin ELISA Kit
orb1669632 96 Tests

Human Somatotropin ELISA Kit

Sign In for Pricing
View Details
Simian PG (Progesterone) ELISA Kit
ELK11557-01 48 Tests

Simian PG (Progesterone) ELISA Kit

Sign In for Pricing
View Details