Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid Peptide (1-42), rat

β-Amyloid (1-42), rat is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Solubility

DMSO: 50mg/mL

Molecular Weight

4418.05

Notes

For research use only.

AA Sequence

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klf15 AAV siRNA Pooled Vector
25745166 1.0 µg

Klf15 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lrp2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4423504 1.0 µg DNA

Lrp2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant ASFV Ken-126 Protein (aa 1-175)
VAng-0875Lsx-500g 500 µg

Recombinant ASFV Ken-126 Protein (aa 1-175)

Sign In for Pricing
View Details
Defb26 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
17972114 3x 1.0 µg

Defb26 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Luc7l2 sgRNA CRISPR Lentivector set (Mouse)
K4814601 3x 1.0 µg

Luc7l2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Tspan10 Pre-designed siRNA Set B
SI115363B 1 Each

Mouse Tspan10 Pre-designed siRNA Set B

Sign In for Pricing
View Details